PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g081080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 613aa    MW: 68586.7 Da    PI: 5.4625
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g081080.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-192579256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    r+ +++t++q++ Le++F ++++p++++r++L ++l+L  +qVk+WFqN+R++ k
  Csa12g081080.1 25 RTGHRHTPQQIQGLEAFFMECPHPDEAQRQQLCEELKLGPDQVKFWFQNKRTQCK 79
                    555789*********************************************9988 PP

2START93.73.7e-3014029066206
                     CCCGGCT-TT-S....EEEEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EES CS
           START  66 lddkeqWdetla....kaetlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaell 148
                     l+d e+W+e ++    ka+tl v+ s        ++l +m  +l  lsplvp R+f++vR++++ ++g+w+i+dvS +  ++   ++s+    ++
  Csa12g081080.1 140 LKDQEKWKELFPtmvnKAKTLYVLGSElpirencNILRVMWEKLHILSPLVPpREFMIVRCCQEISKGVWIIADVSHNDFDFDFVNASC---YKR 231
                     5666699988888888**********************************************************887777776655555...559 PP

                     SEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 149 pSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     pSg+li++++n  skv w+ehv++  +l  h ++r l++ g   gak+w atl+r ce+
  Csa12g081080.1 232 PSGCLIQSMPNAQSKVMWIEHVEVAHKLDtHKIYRELLSGGSGYGAKRWIATLERMCER 290
                     ****************************99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-18982IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-191785IPR009057Homeodomain-like
PROSITE profilePS5007115.5322181IPR001356Homeobox domain
SMARTSM003893.3E-182385IPR001356Homeobox domain
CDDcd000861.69E-172482No hitNo description
PfamPF000469.8E-172679IPR001356Homeobox domain
SMARTSM002342.7E-975290IPR002913START domain
PROSITE profilePS5084828.499134293IPR002913START domain
SuperFamilySSF559611.51E-18139291No hitNo description
PfamPF018524.2E-24140290IPR002913START domain
SuperFamilySSF559612.2E-6311471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MENDGSGSSC NEQYASEDSK QNGKRTGHRH TPQQIQGLEA FFMECPHPDE AQRQQLCEEL  60
KLGPDQVKFW FQNKRTQCKA QEERADNLSL RGENEILENE NEAMLGALIS VLCPDCGGPP  120
FGIEERKLNF QKLLLENARL KDQEKWKELF PTMVNKAKTL YVLGSELPIR ENCNILRVMW  180
EKLHILSPLV PPREFMIVRC CQEISKGVWI IADVSHNDFD FDFVNASCYK RPSGCLIQSM  240
PNAQSKVMWI EHVEVAHKLD THKIYRELLS GGSGYGAKRW IATLERMCER MALTSNLTLP  300
ASDWSEVIRT GEERRRVLKL GERMIMNFNE MLTMSGKVDF PQQSKCGVRV SMRMNLEAGQ  360
PPGLIVSAAS SLRIPLPPVQ VFDILRKLDT RQQWDVLAYG TVVTEIARIA TGSSETNCLS  420
ILRVHPTQEE NNNGKMIAQE SDKDDMLMLQ DCYMDALGGM LVYAPMDMAT MDTTLSGADV  480
KISDIPILPS DDGTRLRQGR HIDAARLLMD ALGGMLVYAP MDMATMDTTL SGADVKISDI  540
PILPSGFIIS SDGRRSTVED GGTLLTLAFQ ILVSGKTSRS REVNERSVDR VSALISSTVQ  600
RIKGLLNCPD QF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010450732.10.0PREDICTED: homeobox-leucine zipper protein HDG8-like
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8